|
|
Home | Alpha Telephone | Domain Names | Web Hosting | Get Traffic | xrEvidence | xrSoccer United States Patent
Methods using persephin and related growth factors A novel growth factor, persephin, which belongs to the GDNF/neurturin family of growth factors, is disclosed. The mouse and rat amino acid sequences have been identified. Mouse and rat persephin genomic DNA sequences have been cloned and sequenced and the respective cDNA sequences identified. In addition, methods for treating degenerative conditions using persephin, methods for detecting persephin gene alterations and methods for detecting and monitoring patient levels of persephin are provided. Methods for identifying additional members of the persephin-neurturin-GDNF family of growth factors are also provided.
Primary Examiner: Kunz; Gary Assistant Examiner: Hayes; Roberts C. Attorney, Agent or Firm: REFERENCE TO GOVERNMENT GRANT This invention was made with government support under Grant Numbers NS24679 and CA52524. The government has certain rights in this invention. This application is a divisional of U.S. patent application Ser. No. 08/981,739, filed Aug. 31, 1998 now U.S. Pat. No. 6,232,449, which was a continuation-in-part of U.S. patent application Ser. No. 08/615,944, filed Mar. 14, 1996 now abandoned. What is claimed is: 1. A method for promoting the survival of a mesencephalic neuronal cell comprising administering to the cell a persephin polypeptide; said polypeptide comprising an amino acid sequence that contains amino acids at positions indicated in parentheses: Cys (1), Leu (3), Val (10), Leu (13), Gly (14), Leu (15), Gly (16), Tyr (17), Glu (21), Phe (25), Arg (26), Tyr (27), Cys (28), Gly (30), Cys (32), Leu (44), Leu (47), Cys (58), Cys (59), Pro (61), Asp (66), Phe (69), Leu (70), Asp (71), Ser (83), Ala (84), Cys (87), and Cys (89), said positions being identified by alignment with a mouse persephin sequence as set forth in SEQ ID NO:79 or a rat persephin sequence as set forth in SEQ ID NO:82; wherein said persephin amino acid sequence has at least 96% sequence identity with SEQ ID NO:79 or SEQ ID NO:82 and wherein said persephin polypeptide promotes survival of mesencephalic neuronal cells. 2. The method of claim 1, wherein the persephin polypeptide is produced by recombinant methods. 3. The method of claim 1, wherein the persephin polypeptide is SEQ ID NO:80. 4. The method of claim 1 wherein the persephin polypeptide comprises SEQ ID NO:79 or SEQ ID NO:82. 5. The method of claim 1 wherein the persephin polypeptide consists of SEQ ID NO:79 or SEQ ID NO:82. BACKGROUND OF THE INVENTION (1) Field of the Invention This invention relates generally to trophic or growth factors and, more particularly, to novel growth factors of the neurturin-GDNF family of growth factors. (2) Description of the Related Art The development and maintenance of tissues in complex organisms requires precise control over the processes of cell proliferation, differentiation, survival and function. A major mechanism whereby these processes are controlled is through the actions of polypeptides known as "growth factors". These structurally diverse molecules act through specific cell surface receptors to produce these actions. Growth factors, termed "neurotrophic factors" promote the differentiation, growth and survival of neurons and reside in the nervous system or in innervated tissues. Nerve growth factor (NGF) was the first neurotrophic factor to be identified and characterized (Levi-Montalcini et al., J. Exp. Zool. 116:321, 1951 which is incorporated by reference). NGF exists as a non-covalently bound homodimer that promotes the survival and growth of sympathetic, neural crest-derived sensory, and basal forebrain cholinergic neurons. In sympathetic neurons this substance produces neurite outgrowth in vitro and increased axonal and dendritic in growth in vivo. (See Levi-Montalcini and Booker, Proc. Nat'l Acad Sci 46:384-391, 1960; Johnson et al. Science 210:916-918, 1980; Crowley et al., Cell 76:1001-12, 1994 which are incorporated by reference). NGF has effects on cognition and neuronal plasticity, and can promote the survival of neurons that have suffered damage due to a variety of mechanical, chemical, viral, and immunological insults (Snider and Johnson, Ann Neurol 26:489-506, 1989; Hefti, J. Neurobiol 25:1418-35, 1994 which are incorporated by reference). NGF also is known to extensively interact with the endocrine system and in immune and inflammatory processes. (Reviewed in Scully and Otten, Cell Biol Int 19:459-469, 1995; Otten and Gadient, Int. J. Devl Neurosci 13:147-151, 1995 which are incorporated by reference). For example, NGF promotes the survival of most cells. (Horigome et al. J Biol Chem 269:2695-2707, 1994 which is incorporated by reference). In recent years it has become apparent that growth factors fall into classes, i.e. families or superfamilies based upon the similarities in their amino acid sequences. These families include, for example, the fibroblast growth factor family, the neurotrophin family and the transforming growth factor-beta (TGF-.beta.) family. As an example of family member sequence similarities, TGF-.beta. family members have 7 canonical framework cysteine residues which identify members of this superfamily. NGF is the prototype of such a family of growth factors. Brain-derived neurotrophic factor (BDNF), the second member of this family to be discovered, was shown to be related to NGF by virtue of the conservation of all six cysteines that form the three internal disulfides of the NGF monomer (Barde, Prog Growth Factor Res 2:237-248, 1990 and Liebrock et al. Nature 341:149-152, 1989 which are incorporated by reference). By utilizing the information provided by BDNF of the highly conserved portions of two factors, additional members (NT-3, NT-4/5) of this neurotrophin family were rapidly found by several groups (Klein, FASEB J 8:738-44, 1994 which is incorporated by reference). Neurotrophic factors structurally unrelated to NGF have been recently identified. These include factors originally isolated based upon a "neurotrophic action" such as ciliary neurotrophic factor (CNTF) (Lin et al., Science 246:1023-5, 1989 which is incorporated by reference) along with others originally isolated as a result of non-neuronal activities (e.g. fibroblast growth factors (Cheng and Mattson Neuron 1:1031-41, 1991 which is incorporated by reference), IGF-I (Kanje et al, Brain Res 486:396-398, 1989 which is incorporated by reference) leukemia inhibitory factor (Kotzbauer et al, Neuron 12:763-773, 1994 which is incorporated by reference). Glial-derived neurotrophic factor (GDNF), is one such neurotrophic factor structurally unrelated to NGF. GDNF was, thus, a unique factor, which, up until now, was not known to be a member of any subfamily of factors. The discovery, purification and cloning of GDNF resulted from a search for factors crucial to the survival of midbrain dopaminergic neurons, which degenerate in Parkinson's disease. GDNF was purified from rat B49 glial cell conditioned media (Lin et al., Science 260:1130-2, 1993 which is incorporated by reference). Sequence analysis revealed it to be a distant member of the TGF-.beta. superfamily of growth factors, having approximately 20% identity based primarily on the characteristic alignment of the 7 canonical framework cysteine residues (Lin et al., Science 260:1130-2, 1993 which is incorporated by reference). Thus, GDNF could possibly have represented a new subfamily within the TGF-.beta. superfamily. Recombinant GDNF produced in bacteria specifically promotes the survival and morphological differentiation of dopaminergic neurons (Lin et al., Science 260:1130-2, 1993); Tomac et al., Nature 373:335-9, 1995; Beck et al., Nature 373:339-41, 1995 and Ebendal et al., J Neurosci Res 40:276-84, 1995 which are incorporated by reference) and motor neurons (Henderson et al., Science 266:1062-4, 1994; Yan et al., Nature 373:341-4, 1995; and Oppenheim et al., Nature 373:344-6, 1995 which are incorporated by reference). Overall, GDNF was a more potent factor for promoting the survival of motor neurons than the other factors, and it was the only factor that prevented neuronal atrophy in response to these lesions, thereby positioning it as a promising therapeutic agent for motor neuron diseases. It is now generally believed that neurotrophic factors regulate many aspects of neuronal function, including survival and development in fetal life, and structural integrity and plasticity in adulthood. Since both acute nervous system injuries as well as chronic neurodegenerative diseases are characterized by structural damage and, possibly, by disease-induced apoptosis, it is likely that neurotrophic factors play some role in these afflictions. Indeed, a considerable body of evidence suggests that neurotrophic factors may be valuable therapeutic agents for treatment of these neurodegenerative conditions, which are perhaps the most socially and economically destructive diseases now afflicting our society. Nevertheless, because different neurotrophic factors can potentially act preferentially through different receptors and on different neuronal or non-neuronal cell types, there remains a continuing need for the identification of new members of neurotrophic factor families for use in the diagnosis and treatment of a variety of acute and chronic diseases of the nervous system. SUMMARY OF THE INVENTION Briefly, therefore, the present invention is directed to the identification and isolation of substantially purified factors that promote the survival and growth of neurons as well as non-neuronal cells. Accordingly, the inventors herein have succeeded in discovering novel protein growth factors belonging to a family of growth factors for which GDNF was the first known member. The first such newly discovered family member was neurturin and this is the subject of application Ser. No. 08/519,777, now U.S. Pat. No. 5,739,307. Based upon the sequence of GDNF and neurturin the inventors herein have discovered another member of the GDNF-Neurturin family of growth factors referenced herein as persephin (PSP). This growth factor is believed to show at least 85% sequence identity among homologous sequences from different mammalian species although sequence homology may be as low as 65% in non-mammalian species such as avian species. Persephin proteins identified herein include mouse sequences as set forth in SEQ ID NOS:79, 80 and 81 (FIG. 11; amino acid residues 52 through 140, 47 through 142, and 9 through 142, respectively) and rat sequences as set forth in SEQ ID NOS:82 and 83 (FIG. 14; amino acid residues 1 through 89 and 1 through 91, respectively). In addition, human persephin is identified by virtue of its having at least 85% sequence homology with its ortholog, mature mouse persephin, along with the identification of certain conserved amino acid residues contained within human persephin as shown in FIG. 15. Thus, it is believed that human persephin will have 28 amino acids in the aligned sequence between the first and seventh canonical framework cysteine residues as set forth in FIG. 15 with residues numbered from the N-terminal end of the family member aligned sequence being (1) Cys, (3) Leu, (10) Val, (13) Leu, (14) Gly, (15) Leu, (16) Gly, (17) Tyr, (21) Glu, (25) Phe, (26) Arg, (27) Tyr, (28) Cys, (30) Gly, (32) Cys, (44) Leu, (47) Leu, (58) Cys, (59) Cys (61) Pro, (66) Asp, (69) Phe, (70) Leu, (71) Asp, (83) Ser, (84) Ala, (87) Cys, and (89) Cys. Persephin has been identified and obtained by a method based upon the conserved regions of the GDNF-Neurturin family discovered by the inventors herein. Accordingly, a new method has been devised that utilizes degenerate primers constructed from the sequences of these conserved regions for use in the polymerase chain reaction procedure. By utilizing this method the mouse and rat orthologs of the new family member, persephin, have been identified and obtained. The present invention thus provides both amino acid sequences and nucleotide sequences that encode mouse and rat persephin as set forth in the amino acid sequences of SEQ ID NO:79-83 and nucleotide sequences of SEQ ID NOS:84 and 85. Because of the close homology between the mouse and rat sequences (95% sequence identity), it is believed that the human persephin sequence will show a high sequence homology to the mouse and rat sequences. Expression vectors and stably transformed cells are also within the scope of this invention. The transformed cells can be used in a method for producing persephin. In another embodiment, the present invention provides a method for preventing or treating neuronal degeneration comprising administering to a patient in need thereof a therapeutically effective amount of persephin. A patient may also be treated by implanting transformed cells which express persephin or a DNA sequence which encodes persephin into a patient, or cells cultured and expanded by growth in persephin. The present invention also provides compositions and methods for detecting persephin. One method is based upon persephin antibodies and other methods are based upon detecting mRNA and cDNA or genomic DNA encoding persephin using recombinant DNA techniques. Among the several advantages found to be achieved by the present invention, therefore, may be noted the provision of a new growth factor, persephin, for use in preventing the atrophy, degeneration or death of certain cells, in particular neurons; the provision of human persephin by making available the specific sequences of murine and rat persephin from which the human sequence can be identified and obtained; the provision of other members of the neurturin-persephin-GDNF family of growth factors by making available new methods capable of obtaining other family members; the provision of methods for obtaining persephin by recombinant techniques; the provision of methods for preventing or treating diseases producing cellular degeneration and, particularly neuronal degeneration; the provision of methods that can detect and monitor persephin levels in a patient; and the provision of methods that can detect alterations in the persephin gene. BRIEF DESCRIPTION OF THE DRAWINGS FIG. 1 illustrates the purification scheme for preparing neurturin from CHO cells; FIGS. 2A-B illustrates the characterization of fractions eluted from Mono S column in purifying neurturin showing (a) electrophoresis of each fraction on a SDS-polyacrylamide gel and visualization of the proteins by silver stain and (b) the neurotrophic activity present in each fraction in the superior cervical ganglion survival assay; FIGS. 3A-C illustrates the ability of neurturin to maintain survival of superior cervical ganglionic cells in culture showing (a) positive control cells maintained with nerve growth factor (NGF) (b) negative control cells treated with anti-NGF antibodies showing diminished survival and (c) cells treated with anti-NGF and neurturin (approximately 3 ng/ml) showing survival of neurons; FIG. 4 illustrates the concentration-response effect of neurturin in the superior cervical ganglion survival assay; FIG. 5 illustrates the homology of the amino acid sequences for the mature growth factors, human neurturin (hNTN), mouse neurturin (mNTN), rat GDNF (rGDNF), mouse GDNF (mGDNF) and human GDNF (hGDNF) with identical amino acid residues enclosed in boxes; FIG. 6 illustrates the tissue distribution of neurturin mRNA and the mRNA for GDNF using RT/PCR analysis on RNA samples obtained from embryonic day 21 (E21) and adult rats; FIG. 7 illustrates the cDNA (SEQ ID NO:11) and encoded amino acid sequence (SEQ ID NO:7) of human pre-pro neurturin [(SEQ ID NO:11)] showing the pre- region from nucleic acid 1 through 57 (SEQ ID NO:17), the pro- region from nucleic acid 58 through 285 (SEQ ID NO:20) , human neurturin from nucleic acid 286 through 591 (SEQ ID NO:9) and the splice site between nucleic acids 169 and 170 which defines the coding sequence portion of two exons from nucleic acids 1 through 169 (SEQ ID NO:27) and 170 through 594 (SEQ ID NO:28); FIG. 8 illustrates the cDNA (SEQ ID NO:12) and encoded amino acid sequence (SEQ ID NO:8) of mouse pre-pro neurturin [(SEQ ID NO:12)] showing the pre-region from nucleic acid 1 through 57 (SEQ ID NO:18), the pro- region from nucleic acid 58 through 285 (SEQ ID NO:21), mouse neurturin from nucleic acid 286 through 585 (SEQ ID NO:10) and the splice site between nucleic acids 169 and 170 which defines the coding sequence portion of two exons from nucleic acids 1 through 169 (SEQ ID NO:29) and 170 through 588 (SEQ ID NO:30); FIG. 9 illustrates the mouse cDNA sequence containing a 5' non-coding region (SEQ ID NO:13) and a 3' non-coding region (SEQ ID NO:14) each of which are contiguous to the coding region of pre-pro neurturin; FIG. 10 illustrates the percent neuronal survival in E18 rat nodose ganglia neurons treated 24 hours post-plating for NTN, GDNF, BDNF, NGF and AMO; FIG. 11 illustrates the nucleotide (SEQ ID NO:105) and amino acid sequence (SEQ ID NO:111) of murine persephin (SEQ ID NO:79, 80 and 81; amino acid residues 52 through 140, 47 through 142, and 9 through 142, respectively); FIG. 12 illustrates the family member sequence identity in the region between the first and seventh canonical framework cysteine residues aligned beginning with the first canonical framework cysteine for murine GDNF (SEQ ID NO:87), murine neurturin (NTN) (SEQ ID NO:88) and murine persephin (PSP) (SEQ ID NO:89); FIG. 13 illustrates the partial sequence of rat persephin cDNA (SEQ ID NO:97) and the corresponding amino acid sequence (aa19-aa91 of SEQ ID NO:83) obtained by the technique of rapid amplification of cDNA ends; FIG. 14 illustrates the partial sequence beginning with the first canonical framework cysteine for rat persephin (SEQ ID NO:83) and the corresponding polynucleotide sequence (SEQ ID NO:86); FIG. 15 shows the family member aligned partial amino acid sequences from the first through the seventh canonical framework cysteine residues illustrating family member sequence homology of the mature growth factors, human GDNF (aa41-aa133 of SEQ ID NO:76), rat GDNF (aa41-aa133 of SEQ ID NO:78), mouse GDNF (aa41-aa133 of SEQ ID NO:77), human neurturin (NTN) (SEQ ID NO:31), mouse neurturin (SEQ ID NO:32), rat persephin (PSP) (SEQ ID NO:82) and mouse persephin (SEQ ID NO:79) in which boxes enclose the 28 conserved amino acid residues present in all; FIG. 16 illustrates the sequences of TGF-.beta. superfamily members aligned using the Clustal method, from the first canonical framework cysteine to the end of the sequence for transforming growth factor-.beta.1 (TGF.beta.1) SEQ ID NO:150), transforming growth factor-.beta.2 (TGF.beta.2) (SEQ ID NO:151), transforming growth factor.beta.3 (TGF.beta.3) (SEQ ID NO:152), inhibin .beta. A (INH.beta.A) (SEQ ID NO:153), inhibin .beta. B (INH.beta.B) (SEQ ID NO:154), the nodal gene (NODAL) (SEQ ID NO:155), bone morphogenetic proteins 2 and 4 (BMP2 and BMP4) (SEQ ID NOs:156 and 157, respectively), the Drosophila decapentaplegic gene (dpp) (SEQ ID NO:158), bone morphogenetic proteins 5-8 (BMP5, BMP6, BMP7 and BMP8) (SEQ ID Nos:159, 160, 161 and 162, respectively), the Drosophila 60A gene family (60A) (SEQ ID NO:163), bone morphogenetic protein 3 (BMP3) (SEQ ID NO:164), the Vg1 gene (SEQ ID NO:165), growth differentiation factors 1 and 3 (GDF1 and GDF3) (SEQ ID Nos:165 and 167, respectively), dorsalin (dsrin) SEQ ID NO:168), inhibin .alpha. (INH.alpha.) (SEQ ID NO:169), the MIS gene (MIS) (SEQ ID NO:170), growth factor 9 (GDF-9) (SEQ ID NO:171), gial-derived neurotrophic growth factor (GDNF) (SEQ ID NO:172), and neurturin (NTN) (SEQ ID NO:173); FIG. 17 illustrates full length murine persephin gene (SEQ ID NO:131), the amino acid sequence which includes at least a portion of the pre-pro region encoded by the nucleotide sequence in the first reading frame from the initiator methionine codon through the stop codon at nucleotide positions 244-246 (SEQ ID NO:132) and the amino acid sequence which includes mature persephin in the second reading frame from nucleotide position 2 through the stop codon at positions 557-559 (SEQ ID NO:133); FIG. 18 illustrates full length rat persephin gene (SEQ ID NO:134), the amino acid sequence which includes at least a portion of the pre-pro region encoded by the nucleotide sequence in the first reading frame from the initiator methionine codon through the stop codon at nucleotide positions 244-246 (SEQ ID NO:135) and the amino acid sequence which includes mature persephin in the second reading frame from nucleotide position 2 through the stop codon at positions 557-559 (SEQ ID NO:136); FIG. 19 illustrates a western blot analysis using anti-persephin antibodies to detect persephin protein in cell lysates from COS monkey cells transfected with the murine persephin gene (lane 2) or the rat persephin gene (lane 3) compared to cells transfected with the non-recombinant vector alone (pCB6, lane 4) and the mature protein produced by E. Coli (lane 1); FIGS. 20A-B illustrates the murine chimeric molecules (A) PSP/NTN (SEQ ID NO:141) containing the persephin fragment (residues 1-63) and the neurturin fragment (residues 68-100) and (B) NTN/PSP (SEQ ID NO:146) containing the neurturin fragment (residues 1-67) and the persephin fragment (residues 64-96) with the arrow indicating the crossover point in each; FIGS. 21A-B illustrates the survival promoting effect of persephin in murine embrionic day-14 mesencephalic cells cultured for three days (a) in the absence of persephin where almost all of the cells are dead and (b) in the presence of persephin (100 ng/ml) where substantial neuronal call survival is evident; and FIG. 22 illustrates RT/PCT survey for persephin expression in adult mouse tissues showing persephin expression by Kidney cells. DESCRIPTION OF THE PREFERRED EMBODIMENTS The present invention is based upon the identification, isolation and sequencing of a DNA molecule that encodes a new growth factor, persephin. Because of the sequence similarity to neurturin and GDNF, persephin is believed to be capable of promoting cell survival and, in particular, the survival of neurons. Prior to this invention, persephin was unknown and had not been identified as a discrete biological substance nor had it been isolated in pure form. The growth factor, neurturin (NTN) was identified and isolated as set forth in application Ser. No. 08/519,777 filed Aug. 28, 1995, now U.S. Pat. No. 5,739,307, which is incorporated in its entirety by reference. From the sequence of neurturin and the sequence of the closely related growth factor, glial-derived neurotrophic factor (GDNF), the inventors herein have devised and pursued strategies to find additional related factors. Neurturin is approximately 40% identical to GDNF, but less than 20% identical to any other member of the TGF-.beta. superfamily. Together these two proteins define a new subfamily within the TGF-.beta. superfamily. Several sequence regions within neurturin and GDNF were identified that are highly conserved, such that they are likely to be present in any additional members of this subfamily. This sequence information can therefore be used to isolate previously unknown members of this subfamily by designing degenerate oligonucleotides to be used as either primers in PCR reactions or as probes in hybridization studies. Using the new degenerate primer PCR strategy described in Example 11 of application Ser. No. 08/519,777, now U.S. Pat. No. 5,739,307, the inventors herein have succeeded in identifying a third factor, persephin, that is approximately 40-50% identical to both GDNF and neurturin. Primers corresponding to the amino acid sequence from conserved regions of neurturin and GDNF (SEQ ID NO:42 and SEQ ID NO:44) were used to amplify a 77 nt fragment from rat genomic DNA. The resulting products were subcloned into the Bluescript KS plasmid and sequenced. The sequence of one of the amplified products predicted amino acid sequence data internal to the PCR primers that was different from that of GDNF or neurturin but had more than 20% identity with GDNF and neurturin, whereas the sequences of other amplified products we obtained corresponded to GDNF or neurturin, as would be expected. The 22 nucleotide sequences (SEQ ID NO:90) was then aligned with the rat sequences of GDNF and neurturin and found to be unique. This novel sequence, thus, suggested that we had identified a new family member referenced herein as persephin. To obtain additional persephin sequence information, primers containing the unique 22 nucleotide sequence of the amplified fragment were used in the rapid amplification of cDNA ends (RACE) technique (Frohman, M. A. Methods in Enzymology 218:340-356, 1993) using cDNA obtained from neonatal rat brain. An approximately 350 nt fragment was obtained from this PCR reaction which constituted a partial rat persephin cDNA sequence of approximately 350 nucleotides (SEQ ID NO:106). The predicted amino acid sequence of this cDNA was compared to that of GDNF and neurturin, and found to have approximately 40% identity with each of these proteins. Importantly, the characteristic spacing of the canonical framework cysteine residues in members of the TGF-.beta. superfamily was present. Furthermore, in addition to the region of similarity encoded by the degenerate primers used to isolate persephin, another region of high homology shared between GDNF and neurturin, but absent in other members of the TGF-.beta. superfamily, was also present in persephin GDNF ACCRPVAFDDDLSFLDD (aa 60-76) (SEQ ID NO:98) NTN PCCRPTAYEDEVSFKDV (aa 61-77) (SEQ ID NO:99) PSP PCCQPTSYAD-VTGLDD (aa 57-72) (SEQ ID NO:100) (Amino acid numbering uses the first Cys residue as amino acid 1). With the confirmation that persephin was indeed a new member of the GDNF/NTN subfamily, we isolated murine genomic clones of persephin to obtain additional sequence information. Primers corresponding to rat cDNA sequence were used in a PCR reaction to amplify a 155 nucleotide (nt) fragment from mouse genomic DNA which was homologous to the rat persephin cDNA sequence. These primers were then used to obtain murine persephin genomic clones from a mouse 129/Sv library in a P1 bacteriophage vector (library screening service of Genome Systems, Inc., St. Louis, Mo.). Restriction fragments (3.4 kb Nco I and a 3.3 kb Bam H1) from this P1 clone containing the persephin gene were identified by hybridization with a 210 nt fragment of persephin obtained by PCR using mouse genomic DNA and persephin-specific primers. The Nco I and Bam H1fragments were sequenced and found to encode a stretch of amino acids corresponding to that present in the rat persephin RACE product, as well as being homologous to the mature regions of both neurturin and GDNF (FIG. 11). When the amino acid sequences of mature murine GDNF, NTN and PSP are aligned using the first canonical framework cysteine as the starting point, which is done because alternations in the cleavage sites between family members creates variability in the segments upstream of the first cysteine, persephin (91 amino acids) is somewhat smaller than either neurturin (95 amino acids) or GDNF (94 amino acids). The overall identity within this region is about 50% with neurturin and about 40% with GDNF (FIG. 12). Further nucleotide sequencing of the murine persephin NcoI fragment revealed the nucleotide sequence of the entire murine persephin gene as shown in FIG. 17. In addition, the entire rat persephin gene has been determined by sequencing a PCR amplified fragment of rat genomic DNA as shown in FIG. 18. In both the murine and rat persephin gene, an open reading frame extends from the sequence coding for an initiator methionine up to a stop codon at positions 244-246. However, somewhere in this sequence an apparent anomaly occurs such that the sequence encoding the RXXR cleavage site (positions 257-268) and the sequence corresponding to the mature persephin protein (positions 269-556) are not co-linear with this open reading frame. Instead, a second reading frame encodes the cleavage site and the mature persephin. The two cogent reading frames are shown in FIGS. 17 and 18. Irrespective of this apparent anomaly, mammalian cells express persephin from either the murine or rat full length genomic sequence (see Example 14 below). The N-terminus of persephin was predicted by reference to the N-terminal regions of neurturin or GDNF. Using neurturin sequence homology and cleavage signals, a characteristic RXXR cleavage motif is present beginning 9 residues upstream of the first canonical framework cysteine of persephin which would suggest that mature murine persephin would contain 5 amino acids (ALAGS) (SEQ ID NO:103) upstream of this cysteine (as does neurturin). The corresponding 5 amino acids in rat persephin are ALPGL (SEQ ID NO:112). Using these parameters, mature persephin would consist of 96 amino acids and have a predicted molecular mass of 10.4 kD. Using GDNF sequence homology and cleavage signals, on the other hand suggests that the N-terminus upstream from the first cysteine of persephin could be longer, in accord with that observed for GDNF which is 40 residues. A characteristic RXXR cleavage motif is thus located 47 residues upstream of the first cysteine and this would suggest that mature persephin would contain 43 amino acids (VRIPGGLPTPQFLLSKPSLCLTILLYLALGNNHVRLPRALAGS) (SEQ ID NO:104) upstream of this cysteine. Using these parameters, mature persephin would consist of 134 amino acids and have a predicted molecular mass of 14.5 kD. Thus, mature persephin may exist in either or both of the 96 amino acid predicted 10.4 kD or for the 134 amino acid predicted 14.5 kD form. By "mature" growth factor reference is made to the secreted form of the growth factor in which any pre- or pro- regions have been cleaved and which may exist as a monomer or, by analogy to other members of the TGF-.beta. superfamily, in the form of a homodimer linked by disulfide bonds. The discovery of the new growth factor, persephin, as described above is a result of the prior discovery by the inventors herein of neurturin. Thus, the experiments leading to the discovery of neurturin are relevant to the current discovery of persephin and to the predicted human form of persephin as well as to the biological activity of persephin. Neurturin was identified and isolated by the inventors herein from conditioned medium for CHO cells. The initial neuronal survival promoting activity was identified by the inventors in a partially purified preparation of this CHO-conditioned medium. Preparation of conditioned medium for a given cell line is well known in the art (for example, see Reid, in Methods in Enzymology Vol. LVIII, Cell Culture, Jakoby and Pastan, Eds., Academic Press, San Diego, pp 161-164, 1979; Freshney, Culture of Animal Cells in A Manual of Basic Technique, 2d Ed., Wiley-Liss, NY, p. 84, 1987 which are incorporated by reference). Thus, although in the present work CHO cells were cultured and the conditioned medium used to identify and to obtain neurturin in purified form, one skilled in the art will readily appreciate that any cell that expresses neurturin can be used as a source. Some of the cells that express neurturin are identified below in Example 9 and the inventors herein believe that any of the cells identified as expressing neurturin can be used to obtain conditioned medium from which neurturin can be isolated. In the isolation of neurturin from the CHO cell conditioned medium, an initial crude conditioned medium can be obtained by centrifugation and/or filtration to remove cellular debris. For further purification, one skilled in the art will readily appreciate that any of a number of methods known in the art can be used to isolate and purify neurturin from a biological sample such as affinity chromatography, ion exchange chromatography, preparative electrophoresis or the like wherein the methods are used either individually or in combination. The cell survival promoting effect of neurturin can be assessed in any suitable system for assessing cell survival. The inventors herein believe that neurturin can promote survival in a variety of different tissues based upon what is known for other growth factors and upon the observation that neurturin is expressed in a number of tissues in which it is believed to have a survival promoting effect. By virtue of the degree of sequence identity of persephin with its paralogs, neurturin and GDNF and the known actions of these substances in promoting the survival and growth of neuronal and non-neuronal tissues, it is also believed that persephin will promote survival and growth in neuronal tissues as well as a variety of non-neuronal tissues. Indeed, the inventors herein have identified brain, kidney, and heart tissues as tissues expressing persephin which further supports the conclusion that persephin can act to promote growth and survival in neuronal and non-neuronal cells. In the work reported herein, neuronal activity for neurturin was assessed using a sympathetic neuronal survival assay (sympathetic cervical ganglia, SCG) which has been extensively characterized (Martin et al, J Cell Biol 106:829-844, 1989; Deckwerth and Johnson, J Cell Biol 123:1207-1222, 1993; which are incorporated by reference) (see FIG. 3). We also show the survival promoting effects of neurturin on sensory neurons (See FIG. 10). In the same sympathetic and sensory neuronal cell assays, persephin showed little survival potentiating activity. However, in a preparation of CNS neuronal cells of mesencephalic origin, persephin showed neuronal survival potentiating activity. This suggests that persephin will be applicable in the treatment or prevention of diseases involving neuronal degeneration in the CNS such as, for example, Parkinson's disease. By way of illustrating the methods used in the above survival assays, the SCG assay involved the culturing of cells obtained from superior cervical ganglia of rat embryo for 5 days at 37.degree. C. in medium containing nerve growth factor (NGF). The medium was then exchanged with a medium containing no NGF and containing anti-NGF antiserum. Removal of NGF results normally in death of the neurons in 24-72 hours. Neuronal survival was visually assessed under a microscope on days 7-8. Maximum neuronal survival criteria included lack of degeneration of both neuronal cell bodies and neurites. Cell body degeneration was indicated when the neuronal cell body was reduced in size, showed irregular membrane swellings, contained vacuoles, or had lost refractility. A field of neurites was scored as showing signs of disintegration when swellings and blebs appeared along the neurite bundles. Survival was determined by comparison with neurons grown in the presence of NGF (positive control) or in the absence of NGF with NGF antisera (negative control). Activity was quantitated by calculation of a "survival unit". The total survival units in a sample were defined as the minimal volume of an aliquot of the sample which produced maximal survival divided into the total volume of that sample. For example, a volume of 600 ml was eluted from the heparin agarose column and from this eluate, 12.5 .mu.l was the minimum volume that promoted maximal volume. Thus, the survival units in the eluate from the heparin agarose column was 48,000. Specific activity was calculated as the survival units divided by the mg total protein. The intrinsic activity of neurturin is expressed herein in concentration units of pg/ml or pM promoting maximal or half-maximal survival. As shown in FIG. 5, a concentration-response curve of purified neurturin protein indicates that the intrinsic activity of neurturin expressed as an EC.sub.50 is approximately 1.5 ng/ml or approximately 50 pM and an EC.sub.100 is approximately 3ng/ml or approximately 100 pM. Survival units were determined in an assay using approximately 1200 neurons in a 0.5 ml culture assay and a culture period of 48 hours following addition of the fraction. Survival was assessed visually after the 48 hours. Intrinsic activity as shown in FIG. 4 was determined in an assay using approximately 2700 neurons and a culture period of 72 hours. Survival was assessed by fixing the neurons and counting the number of surviving neurons. Because the stability, as assessed by half-life of activity, for neurturin decreases as the number of neurons increases, the intrinsic activity measurement would be expected to be lower than that predicted by Specific Activity determinations. The intrinsic activity measurement would also be expected to be lower than that predicted by specific activity because the survival was measured after 72 hours instead of 48 hours. The purification of neurturin is described in detail in Example 1 below. The conditioned medium starting material was prepared from a derivative of DG44 Chinese hamster ovary cells, DG44CHO-pHSP-NGFI-B (Day et al, J Biol Chem 265:15253-15260, 1990 which is incorporated by reference). The inventors herein have also isolated neurturin in partially purified form from conditioned medium of other derivatives of DG44 Chinese hamster ovary cells and these other cells could be used equally as well as the DG44CHO-pHSP-NGFI-B cells as could the parent DG44 Chinese hamster ovary Cells, ovary cells from other species and cells from other tissues such as those known to express neurturin (see example 9). In preparing the conditioned medium, cells were placed in serum free medium for 2 days at which time conditioned medium is collected and the medium replenished. This cycle was repeated to yield 5 harvests of conditioned medium from each batch of CHO cells. The collected media was centrifuged to remove cellular debris. The first step in purification of neurturin from the CHO cell conditioned medium involved the introduction of the conditioned medium onto a heparin agarose column and the elution of partially purified neurturin therefrom. This step resulted in an 111 fold increase in the specific activity and purification of the protein. The buffer used to apply the medium to the column contains 0.5 M NaCl. At this concentration of NaCl the neurturin binds to the heparin agarose matrix. The inventors herein believe that based upon their isoelectric points, LIF and CNTF would either not bind to the heparin agarose matrix or be washed away from the matrix with buffer containing 0.5 M NaCl. Thus, this step would be expected to isolate neurturin from growth factors such as LIF and CNTF. After washing the column, neurturin was eluted from the column using 1.0 M NaCl. Fur further purification, the eluted material was then diluted and introduced into a column containing SP SEPHAROSE.RTM. High Performance ion exchange resin (Pharmacia, Piscataway, N.J.). Material eluted from this column was further purified using fast protein liquid chromatography (FPLC) on a Chelating Superose HR 10/2 column charged with Cu** (Pharmacia, Piscataway, N.J.). Eluted fractions from the Cu** superose column were introduced into a Mono S HR 5/5 cation exchange column (Pharmacia, Piscataway, N.J.) for further FPLC purification. The composition of the proteins in the Mono S fractions were analyzed using non-reducing SDS-PAGE and silver staining. Fractions collected from the columns at each stage of purification were assayed for biological activity using the neuronal survival assay and for protein content using the dye binding method of Bradford (Anal Biochem 72:248-254, 1976 which is incorporated by reference) with a Bio-Rad protein assay dye reagent (Bio-Rad Laboratories, Inc., Hercules, Calif.). The progressive purification using the above steps is shown in table 1. TABLE 1 Specific Protein.sup.a Activity.sup.b Activity.sup.d Yield Purification (mg) (units) (units/mg) (%) (fold) Conditioned 5000 48000.sup.c 9.6 -- -- Medium Heparin 45 48000 1068 100 111 Agarose SP Sepharose 5.3 48000 9058 100 943 Cu++ 0.31 30000 96700 62 10070 Superose Mono S 0.004 15000 3750000 31 390000 .sup.a mg protein was determined using the dye binding method of Bradford (Anal Biochem 72:248, 1976). .sup.b The total activity units or survival units in a sample were defined as the minimal volume of an aliquot of the sample which produced maximal survival divided into the total volume of that sample. .sup.c Activity for Conditioned Medium was derived from the assumption that 100% of the activity was recovered in the heparin agarose fraction because the activity of conditioned medium was too low to be directly assayed. .sup.d Specific Activity was the Activity units divided by the mg total protein. The results of this analysis along with the results of the neuronal survival assay of fractions revealed that a protein having an apparent molecular weight of about 25 kD co-purified with the sympathetic neuron survival activity. The purified material isolated from CHO cell conditioned medium was used to determine partial amino acid sequences of the protein in CHO cell conditioned medium and subsequently as a basis for determining the sequences in different species. The N-terminal amino acid sequence was determined using an automated protein/peptide sequencer and the first 16 amino acids were considered to be, with uncertainty as to position 6, Ser-Gly-Ala-Arg-Pro-Xaa-Gly-Leu-Arg-Glu-Leu-Glu-Val-Ser-Val-Ser where Xaa was an unknown amino acid (SEQ ID NO:3). Internal amino acid fragments were obtained from the purified material following digestion with protease enzymes and the sequences determined. Three internal fragments thus obtained were (1) with uncertainty as to positions 1, 2 and 6, Xaa.sub.1 -Cys-Ala-Gly-Ala-Xaa.sub.2 -Glu-Ala-Ala-Val where Xaa.sub.1 was unknown amino acid, Xaa.sub.2 was Ser or Cys (SEQ ID NO:4); (2) with uncertainty as to positions 1, 2, 4, 10, 17 and 22, Xaa.sub.1 -Xaa.sub.2 -Val-Glu-Ala-Lys-Pro-Cys-Cys-Gly-Pro-Thr-Ala-Tyr-Glu-Asp-Xaa.sub.3 -Val-Ser-Phe-Leu-Ser-Val where Xaa.sub.1 and Xaa.sub.2 were unknown, Xaa.sub.3 was Gln or Glu (SEQ ID NO:5) and (3) Try-His-Thr-Leu-Gln-Glu-Leu-Ser-Ala-Arg (SEQ ID NO:6). Based upon these partial amino acid sequences, DNA probes and primers can be made and used to obtain cDNA clones from different species based upon high sequence conservation between mammalian species. The human cDNA and inferred amino acid sequence is shown in FIG. 7 and the mouse cDNA and inferred amino acid sequence is shown in FIG. 8. The cDNA clone from mouse was 1.0 kb having an open reading frame of 585 nucleotides (SEQ ID NO:12) encoding the mouse pre-pro neurturin protein (SEQ ID NO:8, FIG. 8). In addition, non-coding regions have been identified at both the 5' and 3' ends of the coding region as shown in FIG. 9. (SEQ ID NO:13, 5' non-coding region, nucleic acids -348 through -1; SEQ ID NO:14, 3' non-coding region, nucleic acids 589 through 675). The mouse neurturin sequence can be used to obtain PCR primers for use in identifying homologs from other species. A human 192 nucleotide fragment from human genomic DNA was amplified by this method and further used to screen a human genomic library to obtain clones containing the human neurturin genomic locus. The human cDNA sequence was deduced from the sequencing of these clones. (FIG. 7, cDNA sequence of human pre-pro neurturin). Reference to persephin or to neurturin herein is intended to be construed to include growth factors of any origin which are substantially homologous to and which are biologically equivalent, respectively, to the persephin characterized and described herein or to the neurturin characterized and described herein. Such substantially homologous growth factors may be native to any tissue or species and, similarly, biological activity can be characterized in any of a number of biological assay system. Reference to pre-pro neurturin herein is intended to be construed to include pre-pro growth factors containing a pre- or leader or signal sequence region, a pro- sequence region and neurturin as defined herein. The terms "biologically equivalent" are intended to mean that the compositions of the present invention are capable of demonstrating some or all of the same growth properties in a similar fashion, not necessarily to the same degree as the neurturin isolated from the CHO cell conditioned medium herein or recombinantly produced human or mouse or rat neurturin or persephin as the case may be. By "substantially homologous" it is meant that the degree of sequence identity of neurturin orthologs including human and mouse neurturin as well as neurturin from any other species or the degree of sequence identity of persephin orthologs including human, mouse and rat persephin as well as persephin from any other species, is greater than that between paralogs such as persephin and neurturin or persephin and GDNF, and greater than that reported previously for members of the TGF-.beta. superfamily (For discussion of homology of TGF-.beta. superfamily members see Kingsley, Genes and Dev 8:133-46, 1994 which is incorporated by reference). Sequence identity or percent identity is intended to mean the percentage of some residues between two sequences. The reference sequence is mouse persephin when determining percent identity with mouse GDNF and mouse neurturin and rat persephin when determining percent identity with rat GDNF and rat neurturin. Referencing is to human neurturin when determining percent identity with non-human neurturin, to human neurturin when determining percent identity with non-neurturin growth factors and to human GDNF when determining percent identity of non-neurturin growth factors with GDNF. In all of the above comparisons, the two sequences being compared are aligned using the Clustal method (Higgins et al, Cabios 8:189-191, 1992) of multiple sequence alignment in the Lasergene biocomputing software (DNASTAR, INC, Madison, Wis.). In this method, multiple alignments are carried out in a progressive manner, in which larger and larger alignment groups are assembled using similarity scores calculated from a series of pairwide alignments. Optimal sequence alignments are obtained by finding the maximum alignment score, which is the average of all scores between the separate residues in the alignment, determined from a residue weight table representing the probability of a given amino acid change occurring in two related proteins over a given evolutionary interval. Penalties for opening and lengthening gaps in the alignment contribute to the score. The default parameters used with this program are as follows: gap penalty for multiple alignment=10; gap length penalty for multiple alignment=10; k-tuple value in pairwise alignment=1; gap penalty in pairwise alignment=3; window value in pairwise alignment=5; diagonals saved in pairwise alignment=5. The residue weight table used for the alignment program is PAM250 (Dayhoff et al., in Atlas of Protein Sequence and Structure, Dayhoff, Ed., NBRF, Washington, Vol. 5, suppl. 3, p. 345, 1978). Percent conservation is calculated from the above alignment by adding the percentage of identical residues to the percentage of positions at which the two residues represent a conservative substitution (defined as having a log odds value of greater than or equal to 0.3 in the PAM250 residue weight table). Conservation is referenced to mouse persephin when determining percent conservation with persephin from other species or with non-persephin growth factors; referenced to human neurturin when determining percent conservation with non-human neurturin or with non-neurturin growth factors, and eferenced to human GDNF when determining percent conservation to non-persephin, non-neurturin growth factors with GDNF. Conservative amino acid changes satisfying this requirement are: R-K; E-D, Y-F, L-M; V-I, Q-H. Table 2 shows the calculations of identity (I) and conservation (C) for comparisons of persephin and neurturin and GDNF from various species. Comparisons were made between mouse persephin from the first canonical framework cysteine to the end (SEQ ID NO:89) and rat persephin from the first canonical framework cysteine to the end (SEQ ID NO:83); between mouse persephin and mouse GDNF from the first cysteine to the end (mGDNF/C-END, SEQ ID NO:87) or mouse neurturin from the first cysteine to the end (MNTN/C-END, SEQ ID NO:88); and between rat persephin and rat GDNF from the first cysteine to the end (rGDNF/C-End). Neurturin comparisons were between mature human and mature mouse neurturin (hNTN and mNTN, respectively) and between each of these and mature human, rat and mouse GDNF (hGDNF, rGDNF and mGDNF, respectively) as shown in the table. TABLE 2 COMPARISON % IDENTITY % CONSERVATION mPSP v. rPSP 96 98 mPSP v. mNTN/C-END 51 54 mPSP v. mGDNF/C-END 41 46 rPSP v. rGDNF/C-END 42 45 hNTN v. mNTN 90 93 hNTN v. rGDNF 44 53 hNTN v. mGDNF 43 52 hNTN v. hGDNF 43 53 mNTN v. rGDNF 42 52 mNTN v. mGDNF 41 51 mNTN v. hGDNF 41 52 The degree of homology between the mouse persephin and rat persephin is about 96% and it is believed that the degree of homology between either mouse or rat persephin and human persephin is at least about 85% identity based upon a similar comparison with neurturin. The neurturin comparisons as shown in Table 2 indicate mature mouse and human neurturin proteins have about 90% sequence identity. Furthermore, all persephin and neurturin homologs of non-human mammalian species are believed to similarly have at least about 85% sequence identity with human persephin and neurturin, respectively. For non-mammalian species such as avian species, it is believed that the degree of homology with persephin or neurturin is at least about 65% identity with human persephin or human neurturin, respectively. By way of comparison, the variations between family members of the neurturin-persephin-GDNF family of growth factors can be seen by the comparison of persephin and GDNF or neurturin and GDNF. Mouse and rat persephin have about 35 to 40% sequence identity with mouse and rat GDNF respectively. Similarly, human and mouse neurturin have about 40% sequence identity and about 50% sequence conservation with human, mouse and rat GDNF. It is believed that the different family members also have a similar sequence identity of about 40% of that of neurturin, about 40 of that of persephin and about 40% of that of GDNF and within a range of about 30% to about 85% identity with neurturin, within a range of about 30% to about 85% identity with persephin and within a range of about 30% to about 85% sequence identity with GDNF. Thus, a given member of the GDNF-neurturin-persephin family would be expected to have lesser sequence identity with any other family member of the same species than is present in orthologs of that family member in other species just as human GDNF and human neurturin are more closely related to mouse GDNF and mouse neurturin, respectively, than to each other or to GDNF and any given family member would be expected to have greater sequence identity with another family member than to any other known member of the TGF-.beta. superfamily (Kingsley, supra). In the case of pre-pro neurturin, homologs of pre-pro neurturin in non-human mammalian species can be identified by virtue of the neurturin portion of the amino acid sequence having at least about 85% sequence identity with human neurturin and homologs of pre-pro neurturin in non-mammalian species can be identified by virtue of the neurturin portion of the amino acid sequence having at least about 65% identity with human neurturin. It is similarly believed that mammalian pre-pro persephin proteins including the human ortholog will have at least about 85% sequence identity in the mature persephin portion of the molecule and that non-mammalian pre-pro persephin proteins will have at least about 65% sequence identity with human pre-pro persephin. Either persephin or neurturin, as the terms are used herein, can also include hybrid and modified forms of persephin or neurturin, respectively, including fusion proteins and persephin or neurturin fragments and hybrid and modified forms in which certain amino acids have been deleted or replaced and modifications such as where one or more amino acids have been changed to a modified amino acid or unusual amino acid and modifications such as glycosolations so long as the hybrid or modified form retains the biological activity of persephin or neurturin. By retaining the biological activity, it is meant that neuronal survival is promoted, although not necessarily at the same level of potency as that of the neurturin isolated from CHO cell conditioned medium or that of the recombinantly produced human or mouse neurturin or human or mouse or rat persephin. Also included within the meaning of substantially homologous is any persephin or neurturin which may be isolated by virtue of cross-reactivity with antibodies to the persephin or neurturin, respectively, as described herein or whose encoding nucleotide sequences including genomic DNA, mRNA or cDNA may be isolated through hybridization with the complementary sequence of genomic or subgenomic nucleotide sequences of cDNA of the persephin or neurturin, respectively, as described herein or fragments thereof. It will also be appreciated by one skilled in the art that degenerate DNA sequences can encode human neurturin or human persephin and these are also intended to be included within the present invention as are allelic variants of neurturin or persephin, respectively. In the case of pre-pro neurturin, alternatively spliced protein products resulting from an intron located in the coding sequence of the pro region may exist. The intron is believed to exist in the genomic sequence at a position corresponding to that between nucleic acids 169 and 170 of the cDNA which, in turn, corresponds to a position within amino acid 57 in both the mouse and human pre-pro neurturin sequences (see FIGS. 7 and 8). Thus, alternative splicing at this position might produce a sequence that differs from that identified herein for human and mouse pre-pro neurturin (SEQ ID NO:11 and SEQ ID NO:12, respectively) at the identified amino acid site by addition and/or deletion of one or more amino acids. Any and all alternatively spliced pre-pro neurturin proteins are intended to be included within the terms pre-pro neurturin as used herein. Although it is not intended that the inventors herein be bound by any theory, it is thought that the human and mouse proteins identified herein as well as homologs from other tissues and species may exist as dimers in their biologically active form in a manner consistent with what is known for other factors of the TGF-.beta. superfamily. In addition to homodimers, the monomeric units of the dimers of neurturin or persephin can be used to construct stable growth factor heterodimers or heteromultimers comprising at least one monomer unit derived from persephin or at least one monomer unit derived from neurturin. This can be done by dissociating a homodimer of neurturin or a homodimer of persephin into its component monomeric units and reassociating in the presence of a monomeric unit of a second or subsequent homodimeric growth factor. This second or subsequent homodimeric growth factor can be selected from a variety of growth factors including neurturin, persephin, GDNF, a member of the NGF family such as NGF, BDNF, NT-3 and NT-4/5, a member of the TGF-.beta. superfamily, a vascular endothelial growth factor, a member of the CNTF/LIF family and the like. Growth factors are thought to act at specific receptors. For example, the receptors for TGF-.beta. and activins have been identified and make up a family of Ser/Thr kinase transmembrane proteins (Kingsley, Genes and Dev 8:133-146, 1994; Bexk et al Nature 373:339-341, 1995 which are incorporated by reference). In the NGF family, NGF binds to the TrkA receptor in peripheral sensory and sympathetic neurons and in basal forebrain neurons; BDNF and NT-4/5 bind to trkB receptors; and NT-3 binds primarily to trkC receptors that possess a distinct distribution within the CNS (Tuszynski et al., Ann Neurol 35:S9-S12, 1994). The inventors herein believe that persephin, neurturin, GDNF and as yet unknown members of this family of growth factors act through specific receptors having distinct distributions as has been shown for other growth factor families. These may be separate receptors or it is also possible that members of the GDNF-neurturin-persephin family may act upon the same receptor as is the case with BDNF and NT-4/5 which act on the trkB receptor. Nevertheless, by forming heterodimers or heteromultimers of persephin or neurturin and one or more other growth factors, the resultant growth factor would be expected to be able to bind to at least two distinct receptor types preferentially having a different tissue distribution. The resultant heterodimers or heteromultimers would be expected to show an enlarged spectrum of cells upon which it could act or provide greater potency. It is also possible that the heterodimer or heteromultimer might provide synergistic effects not seen with homodimers or homomultimers. For example, the combination of factors from different classes has been shown to promote long-term survival of oligodendrocytes whereas single factors or combinations of factors within the same class promoted short-term survival (Barres et al., Development 118:283-295, 1993). Heterodimers can be formed by a number of methods. For example, homodimers can be mixed and subjected to conditions in which dissociation/unfolding occurs, such as in the presence of a dissociation/unfolding agent, followed by subjection to conditions which allow monomer reassociation and formation of heterodimers. Dissociation/unfolding agents include any agent known to promote the dissociation of proteins. Such agents include, but are not limited to, guanidine hydrochloride, urea, potassium thiocyanate, pH lowering agents such as buffered HCl solutions, and polar, water miscible organic solvents such as acetonitrile or alcohols such as propanol or iaopropanol. In addition, for homodimers linked covalently by disulfide bonds as is the case with TGP-.beta. family members, reducing agents such as dithiothreitol and .beta.-mercaptosthanol can be used for dissociation/unfolding and for reassociation/refolding. Heterodimers can also be made by transfecting a cell with two or more factors such that the transformed cell produces heterodimers as has been done with the neurotrophins. (Heymach and Schooter, J Biol Chem 270:12297-12304, 1995). Another method of forming heterodimers is by combining persephin or neurturin homodimers and a homodimer from a second growth factor and incubating the mixture at 37.degree. C. When heterodimers are produced from homodimers, the heterodimers may then be separated from homodimers using methods available to those skilled in the art such as, for example, by elution from preparative, non-denaturing polyacrylamide gels. Alternatively, heterodimers may be purified using high pressure cation exchange chromatography such as with a Mono S cation exchange column or by sequential immunoaffinity columns. It is well known in the art that many proteins are synthesized within a cell with a signal sequence at the N-terminus of the mature protein sequence and the protein carrying such a leader sequence is referred to as a preprotein. The pre- portion of the protein is cleaved during cellular processing of the protein. In addition to a pre- leader sequence, many proteins contain a distinct pro sequence that describes a region on a protein that is a stable precursor of the mature protein. Proteins synthesized with both pre- and pro- regions are referred to as preproproteins. In view of the processing events known to occur with other TGF-.beta. family members as well as the sequences determined herein, the inventors believe that the forms of persephin or neurturin protein as synthesized within a call in the pre-pro persephin or a pre-pro neurturin. In the case of neurturin, the pre-pro neurturin is believed to contain an N-terminal 19 amino acid signal sequence (human pre- signal sequence, SEQ ID NO:15, FIG. 7, amino acids 1 through 19 encoded by SEQ ID NO:17, FIG. 7 , nucleic acids 1 through 57; mouse pre- signal sequence, SEQ ID NO:16, FIG. 8, amino acids 1 through 19, encoded by SEQ ID NO:18, FIG. 8, nucleic acids 1 through 57). It is known that the full length of a leader sequence is not necessarily required for the sequence to act as a signal sequence and, therefore, within the definition of pre- region of neurturin is included fragments thereof, usually N-terminal fragments, that retain the property of being able to act as a signal sequence, that is to facilitate co-translational insertion into the membranes of one or more cellular organelles such as endoplasmic reticulum, mitochondria, golgi, plasma membrane and the like. The neurturin signal sequence is followed by a pro-domain which contains an RXXR proteolytic processing site immediately before the N-terminal amino acid sequence for the mature neurturin. (human pro- region sequence, SEQ ID NO:19, FIG. 7, amino acids 20 through 95 encoded by the nucleic acid sequence SEQ ID NO:20, FIG. 7 nucleic acids 58 through 285; mouse pro- region sequence, SEQ ID NO:22, FIG. 8, amino acids 19 through 95 encoded by nucleic acid sequence SEQ ID NO:21, FIG. 8 , nucleic acids 58 through 285). The neurturin pre- and pro- regions together comprise a pre-pro sequence identified as the human pre-pro sequence (SEQ ID NO:23, FIG. 7 , amino acids 1 through 95 encoded by SEQ ID NO:25, nucleic acids 1 through 285) and the mouse pre-pro sequence (SEQ ID NO:24, FIG. 8, amino acids 1 through 95 encoded by SEQ ID NO:26, nucleic acids 1 through 285). The pre- region sequences and pro- region sequences as well as the pre-pro region sequences can be identified and obtained for non-human mammalian species and for non-mammalian species by virtue of the sequences being contained within the pre-pro neurturin as defined herein. It is believed that persephin is similarly associated with pre- end pro- regions to constitute a pre-pro persephin sequence. Using the above landmarks, the mature, secreted neurturin molecule is predicted to be approximately 11.5 kD which is likely to form a disulfide linked homodimer of approximately 23 kD by analogy to other members of the TGF-.beta. family. The predicted approximately 23 kD protein is consistent with the 25 kD neurturin protein purified from CHO cell conditioned media being a homodimer. The inventors herein have detected an approximately 11.5 kD neurturin protein from conditioned medium of Chinese hamster ovary cells transfected with the neurturin expression vector (pCMV-NTN-3-1) using SDS-PAGE under reducing conditions and this protein is thought to be the monomer. As discussed above, a mature persephin molecule predicted on the basis of homology to neurturin would contain 5 amino acids upstream from the first canonical framework cysteine thus having 96 amino acids and a predicted molecular mass of 10.4 kD. A mature persephin molecule based upon homology to GDNF would contain 43 amino acids upstream from the first canonical framework cysteine thus having 134 amino acids and a predicted molecular mass of 14.5 kD. The nucleotide sequences of neurturin pre- and/or pro- regions or similar regions that are believed to be associated with persephin DNA can be used to construct chimeric genes with the coding sequences of other growth factors or proteins and, similarly, chimeric genes can be constructed from the coding sequence of neurturin coupled to sequences encoding pre- and/or pro- regions from genes for other growth factors or proteins. (Booth et al., Gene 146:303-8, 1994; Ibanez, Gene 146:303-8, 1994; Storici et al., FEBS Letters 337:303-7, 1994; Sha et al J Cell Biol 114:827-839, 1991 which are incorporated by reference). Such chimeric proteins can exhibit altered production or expression of the active protein species. A preferred neurturin has been identified and isolated in purified form from medium conditioned by CHO cells. Also preferred is neurturin prepared by recombinant DNA technology. Similarly, a preferred persephin according to the present invention is prepared by recombinant DNA technology. By "pure form" or "purified form" or "substantially purified form" it is meant that a persephin or neurturin composition is substantially free of other proteins which are not persephin or neurturin, respectively. Recombinant persephin or neurturin may be made by expressing the DNA sequences encoding persephin or neurturin, respectively, in a suitable transformed host cell. Using methods well known in the art, the DNA encoding persephin or neurturin may be linked to an expression vector, transformed into a host call and conditions established that are suitable for expression of persephin or neurturin, respectively, by the transformed cell. Any suitable expression vector may be employed to produce recombinant human persephin or recombinant human neurturin such as, for example, the mammalian expression vector pCB6 (Brewer, Meth Cell Biol 43:233-245, 1994) or the E. coli pET expression vectors, specifically, pET-30a (Studier et al., Methods Enzymol 185:60-89, 1990 which is incorporated by reference) both of which were used herein. Other suitable expression vectors for expression in mammalian and bacterial cells are known in the art as are expression vectors for use in yeast or insect cells. Baculovirus expression systems can also be employed. Persephin or neurturin may be expressed in the monomeric units or such monomeric form may be produced by preparation under reducing conditions. In such instances refolding and renaturation can be accomplished using one of the agents noted above that is known to promote dissociation/association of proteins. For example, the monomeric form can be incubated with dithiothreitol followed by incubation with oxidized glutathione disodium salt followed by incubation with a buffer containing a refolding agent such as urea. In the case of neurturin, by analogy with the N-terminal sequence and internal fragments of the neurturin purified from CHO call conditioned medium, the mature mouse sequence was deduced and from this the mature human form was predicted using the sequence from the human gene. The amino acid sequence of the mature human form is as shown in FIG. 5 (hNTN, SEQ ID NO:1). The material purified from CHO call conditioned medium is considered to be mature neurturin and may exist as a dimer or other multimer and may be glycosylated or chemically modified in other ways. Persephin, like neurturin, may also exist as a dimer or other multimer and may be glycosylated or chemically modified in other ways. As noted above, the mouse and human nucleic acid sequences suggest that neurturin is initially translated as a pre-pro polypeptide and that proteolytic processing of the signal sequence and the "pro" portion of this molecule results in the mature sequence, referenced herein as "mature neurturin", as obtained from medium condition by CHO cells and as exists in human and in non-human species in homologous form. Neurturin, therefore, includes any and all "mature neurturin" sequences from human and non-human species and any and all pre-pro neurturin polypeptides that may be translated from the neurturin gene. As with neurturin, the persephin in the present invention also includes any and all mature persephin sequences from human and non-human species and any and all pre-pro persephin polypeptides that may be translated from the persephin gene. It is believed that the coding sequence for the pre-pro-neurturin polypeptide begins at the first ATG codon encoding methionine at the 5' end of the clone (position 1 in FIG. 9) which is positioned in the same reading frame as the sequence encoding the amino acid sequences obtained from the purified neurturin. Downstream from the first codon is the largest open reading frame containing the coding sequence for the pre- and pro-regions followed by the coding sequence for the mature mouse neurturin. Sequence analysis of the murine neurturin genomic clones identified a 0.5 kb intron located between nucleotide 169 and 170 of the pre-pro neurturin from the cDNA clones. This intron is located in the coding sequence of the pro- region of the pre-pro-neurturin protein. Thus, it is believed that the mouse neurturin gene contains at least two exons, one of which contains the coding sequences upstream from the splice site and the other contains the coding sequence downstream (FIG. 8, SEQ ID NO:29, SEQ ID NO: 30). It is known that the gene for GDNF contains an intron located at an analogous position and an alternately spliced form of GDNF has been detected by RT-PCR experiments (Suter-Crazzolare and Unsicker, Neuroreport 5: 2486-2488, 1994 which is incorporated by reference). This alternate form results from the use of a splice site in the second coding axon located 78 by 3' to the original splice site reported. The alternately spliced form encodes a GDNF protein with a deletion of 26 amino acids relative to the originally reported form. The two forms are expressed in different ratios in different tissues. We have not detected alternately spliced forms of neurturin in RT-PCR and RACE experiments using mouse P1 brain and P2 liver cDNAs. The possibility exists, however, that alternate splice sites in the neurturin gene may be utilized in different tissues. The coding sequence of the human neurturin cDNA has been deduced from the sequence of the human neurturin genomic clones. The coding sequence of the human cDNA, like that of the mouse cDNA, is interrupted by an intron between nucleotides 169 and 170 of the coding sequence. Thus, the human neurturin gene is believed to contain at least two exons, one of which contains the coding sequence upstream from the splice site end the other contains the coding sequence downstream (FIG. 7, SEQ ID NO:27, SEQ ID NO:28). The splice sites at the intron-exon junctions of the human and mouse genes have been conserved. From the deduced amino acid sequence of human neurturin, the earlier predicted N-terminal sequence lies between positions 286 end 339 and the predicted internal sequences lie between positions 385 and 417, positions 474 and 533 and positions 547 and 576. The TGA stop codon at positions 592-594 terminate the open reading frame. The predicted length of the purified pre-pro neurturin is 197 amino acid residues for the human pre-pro neurturin (SEQ ID NO:7) and 195 amino acid residues for the mouse pre-pro neurturin (SEQ ID NO:8). The predicted molecular weight of this polypeptide is 22.2 kD for mouse and 22.4 kd for human. The predicted length of the purified neurturin is 100 amino acid residues end its predicted monomeric molecular weight is 11.5 kD. There are no N-linked glycosylation sites, however, potential 0-linked glycosolation sites occur at amino acid residues in positions 18, 26, 80, 86 and 95 in human neurturin. Glycosylation at any one or combination of these sites would increase the molecular weight of the molecule. In the case of persephin, there are no N-linked glycosylation sites in the region between the first and seventh canonical framework cysteines (SEQ ID NO:79) nor are there any N-linked glyosylation sites in a mature persephin molecule predicted on the basis of homology to neurturin (SEQ ID NO:80). In a mature persephin molecule based upon homology to GDNF there are two potential N-linked glycosylation sites in the 43 amino acids upstream from the first canonical framework cysteine at positions 31 and 32 in SEQ ID NO:81 (corresponding to positions 39 and 40 in the sequence as shown in FIG. 11). Potential 0-linked glycosylation sites occur in persephin in the region between the first and seventh canonical framework cysteines at positions 5, 7, 19, 31, 38, 41, 62, 63, 68 and 83 in SEQ ID NO:79 (FIG. 12) and in a mature persephin molecule predicted on the basis of homology to neurturin (SEQ ID NO:80) there is one additional potential 0-linked glycosylation site one residue upstream from the first canonical framework cysteine (position 51 in the sequence an shown in FIG. 11). In a mature persephin molecule based upon homology to GDNF there are five potential 0-linked glycosylation sites in the 43 amino acids upstream from the first canonical framework cysteine at positions 9, 15, 18, 22 and 43 in SEQ ID NO:81 (corresponding to positions 17, 23, 26, 30 and 51 in the sequence as shown in FIG. 11) along with the ten potential 0-linked glycosylation sites noted above in the region between the canonical framework cysteines (corresponding to positions 48, 50, 62, 74, 81, 84, 105, 106, 111 and 126 in SEQ ID NO:81 and positions 56, 58, 70, 82, 89, 92, 113, 114, 119 and 134 in the sequence as shown in FIG. 11). Different possible cleavage sites may be present in the pre-pro-neurturin sequence. The amino acid sequence of the mature mouse neurturin (FIG. 5 , SEQ ID NO:2) is predicted from alignment with the N-terminal amino acid sequence of the purified Chinese hamster neurturin. A four residue RRAR cleavage site (amino acids 92-95) is found immediately before the predicted N-terminal amino acid of mature mouse neurturin. This RRAR sequence fits the RXXR consensus sequence at which members of the TGF-.beta. superfamily are usually cleaved. This putative RRAR cleavage sequence is conserved in human neurturin. However, the mature human neurturin is predicted to have a two amino acid N-terminal extension relative to mature mouse neurturin when cleaved at this sequence. Since neurturin contains other sequences which fit the RXXR consensus (for example the sequence RRRR at amino acids 90-93) and the specificities of proteases involved in this cleavage are not completely understood, the possibility exists that in some situations, neurturin is cleaved at sites other than the above RRAR sequence, and the mature neurturin protein may have a variable number of amino acids preceding the cysteine residue at position 101 in the mouse sequence (pre-pro protein) and position 103 in the human sequence. Such alternate cleavage sites could be utilized differently among different organisms and among different tissues of the same organism. The N-terminal amino acids preceding the first of the seven conserved cysteines in the mature forms of members of the TGF-.beta. family vary greatly in both length and sequence. Furthermore, insertion of a ten amino acid sequence two residues upstream of the first conserved cysteine does not affect the known biological activities of one family member, dorealin (Basler, K., Edlund, T., Jessell, T. M., and Yamada, T., (1993) Cell 73:687-702). Thus neurturin proteins which contain sequences of different lengths preceding the cysteine 101 in mouse and cysteine 103 in human would be likely to retain their biological activity. It is also believed that persephin proteins which contain sequences of different lengths preceding the first cysteine (residue No. 1 of mouse persephin in FIG. 12 and residue No. 1 of rat persephin in FIG. 14) would be likely to retain their biological activity. The inventors herein believe that at a minimum the sequence of neurturin that will show biological activity will contain the sequence beginning at cysteine 103 and ending at cysteine 196 for human neurturin (FIG. 7 , SEQ ID NO:31) and beginning at cysteine 101 and ending at cysteine 194 for mouse neurturin (FIG. 7 , SEQ ID NO:32). Thus, within the scope of the neurturin polypeptides are amino acid sequences containing SEQ ID NO:31 and amino acid sequences containing SEQ ID NO:32 and nucleic acid sequences encoding these amino acid sequences. Similarly, the inventors herein believe that, at a minimum, the sequence of persephin that will show biological activity will contain the sequence beginning at cysteine 1 and ending at cysteine 87 for mouse persephin (FIG. 12 , SEQ ID NO:79) and beginning at cysteine 1 and ending et cysteine 87 for rat persephin (FIG. 14 , SEQ ID NO:82). Thus, within the scope of persephin of the present invention are amino acid sequences containing SEQ ID NO:79 and amino acid sequences containing SEQ ID NO:82 and nucleic acid sequences encoding these amino acid sequences. The present invention also encompasses nucleic acid sequences including sequences that encode mouse and rat persephin (FIGS. 11 and 14) as well as human persephin in the same manner that neurturin includes human end mouse neurturin nucleic acid sequences (FIGS. 7 and 8). Also included within the scope of this invention are sequences that are substantially the same as the nucleic acid sequences encoding persephin or neurturin, respectively. Such substantially the same sequences may, for example, be substituted with codons more readily expressed in a given host call such as E. coli according to well known and standard procedures. Such modified nucleic acid sequences are included within the scope of this invention. Specific nucleic acid sequences can be modified by those skilled in the art and, thus, all nucleic acid sequences which encode for the amino acid sequences of pre-pro neurturin or persephin or the pre- region or the pro- region of neurturin or persephin can likewise be so modified. The present invention thus also includes nucleic acid sequence which will hybridize with all such nucleic acid sequences--or complements of the nucleic acid sequences where appropriate--and encode for a polypeptide having cell survival or growth promoting activity. The present invention also includes nucleic acid sequences which encode for polypeptides that have survival or growth promoting activity and that are recognized by antibodies that bind to neurturin or by antibodies that bind to persephin. The present invention also encompasses vectors comprising expression regulatory elements operably linked to any of the nucleic acid sequences included within the scope of the invention. This invention also includes host cells--of any variety--that have been transformed with vectors comprising expression regulatory elements operably linked to any of the nucleic acid sequences included within the scope of the present invention. Methods are also provided herein for producing neurturin or persephin. Preparation can be by isolation from conditioned medium from a variety of cell types so long am the cell type produces neurturin or persephin. A second and preferred method involves utilization of recombinant methods by isolating a nucleic acid sequence encoding neurturin or persephin, cloning the sequence along with appropriate regulatory sequences into suitable vectors and cell types, and expressing the sequence to produce neurturin or persephin. A mammalian gene family comprised of four neurotrophic factors has been identified including nerve growth factor (NGF), brain derived neurotrophic factor (BDGF), neurotrophin-3 (NT-3), and neurotrophin-4/5 (NT-4/5). These factors share approximately 60 percent nucleic acid sequence homology (Tuezynaki and Gage, Ann Neurol 35:S9--12, 1994 which is incorporated by reference). The persephin protein and the neurturin protein display no significant homology to the NGF family of neurotrophic factors. Either persephin or neurturin shares lose than about 208 homology with the TGF-.beta. superfamily of growth factors. However, both persephin and neurturin show approximately 40% sequence identity with GDNF and approximately 50% sequence identity with each other. In particular, the positions of the seven cysteine residues present in persephin, neurturin and GDNF are nearly exactly conserved. The inventors herein believe that other unidentified genes may exist that encode proteins that have substantial amino acid sequence homology to persephin, neurturin and GDNF and which function an growth factors selective for the same or different tissues end the same or different biological activities and may act at the same or different receptors. A different spectrum of activity with respect to tissues affected and/or response elicited could result from preferential activation of different receptors by different family members as is known to occur with members of the NGF family of neurotrophic factors (Tuszynski and Gage, 1994, supra). As a consequence of members of a particular gene family showing substantial conservation of amino acid sequence among the protein products of the family members, there is considerable conservation of sequences at the DNA level. This forms the basis for a new approach for identifying other members of the gene family to which GDNF, neurturin and persephin belong. The method used for such identification is cross-hybridization using nucleic acid probes derived from one family member to form a stable hybrid duplex molecule with nucleic acid sequence from different members of the gene family or to amplify nucleic acid sequences from different family members. (see for example, Kaisho et al. FEBS Letters 266:187-191, 1990 which is incorporated by reference). The sequence from the different family member may not be identical to the probe, but will, nevertheless be sufficiently related to the probe sequence to hybridize with the probe. Alternatively, PCR using primers from one family member can be used to identify additional family members. The above approaches have not heretofore been successful in identifying other gene family members because only one family member, GDNF was known. With the identification of neurturin in copending application Ser. No. 08/519,777, however, unique new probes and primers can be made that contain sequences from the conserved regions of this gene family. The same conserved regions are also found in the third family member, persephin. In particular, three conserved regions have been identified herein which can be used as a basis for constructing new probes and primers. The new probes and primers made available from the work with neurturin and persephin make possible this powerful new approach which can now successfully identify other gene family members. Using this new approach, one may screen for genes related to GDNF, neurturin and persephin in sequence homology by preparing DNA or RNA probes based upon the conserved regions in the GDNF and neurturin molecules. Therefore, one embodiment of the present invention comprises probes and primers that are unique to or derived from a nucleotide sequence encoding such conserved regions and a method for identifying further members of the neurturin-persephin-GDNF gene family. Conserved-region amino acid sequences have been identified herein to include Val-Xaa.sub.1 - Xaa.sub.2 -Leu-Gly-Leu-Gly-Tyr where Xaa.sub.1 is Ser, Thr or Ala and Xaa.sub.2 is Glu or Asp (SEQ ID NO:108); Glu-Xaa.sub.1 -Xaa.sub.2 -Xaa.sub.3 -Phe-Arg-Tyr-Cys-Xaa.sub.4 -Gly-Xaa.sub.5 -Cys in which Xaa.sub.1 is Thr, Glu or lys, Xaa.sub.2 is Val, Leu or Ile, Xaa.sub.3 is Leu or Ile, Xaa.sub.4 is Ala or Ser, and Xaa.sub.5 is Ala or Ser, (SEQ ID NO:113); and Cys-Cys-Xaa.sub.1 -Pro-Xaa.sub.2 -Xaa.sub.3 -Xaa.sub.4 -Xaa.sub.5 -Asp-Xaa.sub.6 -Xaa.sub.7 -Xaa.sub.8 -Phe-Leu-Asp-Xaa.sub.9 in which Xaa.sub.1 is Arg or Gln, Xaa.sub.2 is Thr or Val or Ile, Xaa.sub.3 is Ala or Ser, Xaa.sub.4 is Tyr or Phe, Xaa.sub.5 is Glu, Asp or Ala, Xaa.sub.6 is Glu, Asp or no amino acid, Xaa, in val or leu, Xaa.sub.8 is Ser or Thr, and Xaa.sub.9 is Asp or Val (SEQ ID NO:114). Nucleotide sequences containing a coding sequence for the above conserved sequences or fragments of the above conserved sequences can be used as probes. Exemplary probe and primer sequences encoding amino acid sequences end SEQ ID NOS:125-129; primers whose reverse complementary sequences encode amino acid sequences SEQ ID NO:126, SEQ ID NO:127, SEQ ID NO:130; and, in particular, nucleotide sequences, SEQ ID NOS:115-124. Additional primers based upon GDNF and neurturin include nucleic acid sequences encoding amino acid sequences, SEQ ID NO:33, SEQ ID NO:36, SEQ ID NO:40 and SEQ ID NO:41; primers whose reverse complementary sequences encode SEQ ID NO:37, SEQ ID NO:38 and SEQ ID NO:39; and, in particular, nucleic acid sequences, SEQ ID NOS:42-48. Hybridization using the new probes from conserved regions of the nucleic acid sequences would be performed under reduced stringency conditions. Factors involved in determining stringency conditions are wall known in the art (for example, see Sambrook et al., Molecular Cloning, 2nd Ed., 1989 which is incorporated by reference). Sources of nucleic acid for screening would include genomic DNA libraries from mammalian species or cDNA libraries constructed using RNA obtained from mammalian cells cloned into any suitable vector. PCR primers would be utilized under PCR conditions of reduced annealing temperature which would allow amplification of sequences from gene family members other than GDNF, neurturin and persephin. Sources of nucleic acid for screening would include genomic DNA libraries from mammalian species cloned into any suitable vector, cDNA transcribed from RNA obtained from mammalian cells, and genomic DNA from mammalian species. DNA sequences identified on the basis of hybridization or PCR assays would be sequenced and compared to GDNF, neurturin and persephin. The DNA sequences encoding the entire sequence of the novel factor would then be obtained in the same manner as described herein. Genomic DNA or libraries of genomic clones can also be used as templates because the intron/axon structures of GDNF and neurturin are conserved and coding sequences of the mature proteins are not interrupted by introns. Using this approach as described above, the primers designed from the conserved regions of neurturin and GDNF have been used to identify and obtain the sequence of the new family member described herein, persephin. Degenerate primers designed from persephin, neurturin and GDNF can be further used to identify and obtain additional family members. It is believed that all GDNF-neurturin-persephin family members will have a high degree of sequence identity with one or more of the three identified family-member consensus regions in the portion of the sequence between the first and seventh canonical framework cysteines (see FIG. 12). In particular, a now family member is anticipated to have at least a 62.5% identity with the consensus region octapeptide, Val-Xaa.sub.1 -Xaa.sub.2 -Leu-Gly-Leu-Gly-Tyr where Xaa.sub.1 is Ser, Thr or Ala and Xaa.sub.2 is Glu or Asp (SEQ ID NO:108) or at least a 62.5 percent sequence identity with the consensus region octapeptide, Phe-Arg-Tyr-Cys-Xaa.sub.1 -Gly-Xaa.sub.2 -Cys where Xaa.sub.1 and Xaa.sub.2 are alanine or serine (SEQ ID NO:109) or at least a 50 percent sequence identity with the consensus region octapeptide, Asp-Xaa.sub.1 -Xaa.sub.2 -Xaa.sub.3 -Phe-Leu-Asp-Xaa.sub.4 where Xaa.sub.1 is aspartic acid or glutamic acid or no amino acid, Xaa.sub.2 is valine or leucine, Xaa.sub.3 is serine or threonine; and Xaa.sub.4 is valine or aspartic acid (SEQ ID NO:110). The inventors herein believed that any new family member will have 28 amino acids in the aligned sequence between the first and seventh canonical framework cysteine residues as set forth in FIG. 15 with residues numbered from the N-terminal end of the family member aligned sequence being (1) Cys, (3) Leu, (10) Val, (13) Leu, (14) Gly, (15) Leu, (16) Gly, (17) Tyr, (21) Glu, (25) Phe, (26) Arg, (27) Tyr, (28) Cys, (30) Gly, (32) Cys, (44) Leu, (47) Leu, (58) Cys, (59) Cys (61) Pro, (66) Asp. (69) Phe, (70) Leu, (71) Asp, (83) Ser, (84) Ala, (87) Cys, and (89) Cys, however, it is possible that there may be as many as three mismatches. Although neurturin has been purified on the basis of its ability to promote the survival of a particular neuronal type, this factor will act on other neuronal cell types as well. For example, neurturin is shown herein to promote the survival of nodose sensory ganglia neurons (sea Example 3). Neurturin is also likely to promote the survival of non-neuronal cells. Indeed, all the growth factors isolated to data have been shown to act on many different cell types (for example see Scully and Otten, Cell Biol Int 19:459-469, 1005; Hefti, Neurotrophic Factor Therapy 25:1418-1435, 1994 which are incorporated by reference). It is known that NGF acts on sympathetic neurons, several types of sensory neurons and certain populations of CNS neurons. GDNF, which is more closely related to neurturin, has been shown to act on dopaminergic, sympathetic, motor and several sensory neurons (Henderson et al. Supra, 1994: Miles et al, J Cell Biol 130:137-148, 1995; Yan et al, Nature 373:341-344, 1995; Lin et al, Science 260:1130-1132, 1993; Trupp et al, J Cell 8101 130:137-148, 1995; Martin et al Brain Res 683:172-178, 1995; Bowenkamp et al J Comp Neurol 355:479-489, 1995 which are incorporated by reference). Thus, it is likely that in addition to peripheral sympathetic and sensory neurons, neurturin can act on a wide variety of central and peripheral neuronal call types. On the basis of the structural similarities of persephin to the sequences of neurturin and GDNF, persephin is also believed to promote the survival and growth of neuronal as wall as non-neuronal cells. Indeed, as noted above, all the growth factors isolated to data have been shown to act on many different cell types (Scully and Otten, Cell Biol Int 19:459-469, 1005; Hefti, Neurotrophic Factor Therapy 25:1418-1435, 1994). Furthermore, the inventors herein have identified brain and heart tissues as tissues expressing persephin, which further supports the conclusion that persephin can act to promote survival and growth in a variety of neuronal and non-neuronal cells. As an example of the actions of neurotrophic factors on non-neuronal tissues, the prototypical neurotrophic factor, NGF, also acts upon mast cells to increase their number when injected into newborn rate (Aloe, J Neuroimmunol 18:1-12, 1988). In addition, mast cells express the trk receptor and respond to NGF such that NGF is a mast cell secretogogue and survival promoting factor (Horigome et al., J Biol Chem 269:2695-2707, 1994 which is incorporated by reference). Moreover, members of the TGF-.beta. superfamily act on many cell types of different function and embryologic origin., The inventors herein have identified several non-neuronal tissues in which neurturin is expressed including blood, bone marrow, neonatal liver and mast cells. This suggests a role for neurturin in hematopoiesis, inflammation, allergy, and cardiomyopathy. Similarly, the inventors herein have identified brain and heart as tissues in which persephin is expressed and it is further believed that persephin is expressed in a number of other neuronal and non-neuronal tissues. Thus, persephin may also have a role in hematopoiesis, inflammation, allergy and cardiomyopathies. Neurotrophic factors of the NGF family are thought to act through factor-specific high affinity receptors (Tuszyneki and Gage, 1994, supra). Only particular portions of the protein acting at a receptor Site are required for binding to the receptor. Such particular portions or discrete fragments can serve as an agonist where the substance activates the receptor to elicit the promoting action on call survival and growth and antagonists to neurturin or persephin where they bind to, but do not activate, the receptor or promote survival and growth. Such portions or fragments that are agonists and those that are antagonists are also within the scope of the present invention. Synthetic, pan-growth factors can also be constructed by combining the active domains of persephin or neurturin with the active domains of one or more other growth factors. (For example, see Ilag et al., Proc Nat'l Acad Sci 92:607-611, 1995 which is incorporated by reference). These pan-growth factors would be expected to have the combined activities of neurturin or persephin and the one or more other growth factors. As such they are believed to be potent end multispecific growth factors that are useful in the treatment of a wide spectrum of degenerative diseases and conditions including conditions that can be treated by any and all of the parent factors from which the active domains were obtained. Such pan-growth factors might also provide synergistic effects beyond the activities of the parent factors (Barrel et al., supra). Pan-growth factors within the scope of the present invention can also include chimeric or hybrid polypeptides that are constructed from portions of fragments of at least two growth factors. Growth factors of the TGF-.beta. superfamily are structurally related having highly conserved sequence landmarks whereby family members are identified. In particular, seven canonical framework cysteine residues are nearly invariant in members of the superfamily (Kingsley, Genes & Dev 8:133-146, 1994 which is incorporated by reference) (see FIG. 17). Chimeric polypeptide molecules can, therefore, be constructed from a sequence that is substantially identical to a portion of either the persephin or the neurturin molecule, up to one or more crossover points, and one or more sequences each of which is substantially identical with a portion of another TGF-.beta. superfamily member extending on the other side of the corresponding one or more crossover points. For example, a portion of the amino terminal and of the persephin polypeptide can be combined with a portion of the carboxy terminal end of a neurturin polypeptide or alternatively a portion of the amino terminal end of a neurturin polypeptide can be combined with a portion of the carboxy terminal and of a persephin polypeptide. Such portions of neurturin or persephin polypeptides are preferably from about 5 to about 95, more preferably from about 10 to about 90, still more preferably from about 20 to about 80 and most preferably from about 30 to about 70 contiguous amino acids and such portions of another, non-persephin or, as the case may be, non-neurturin TGF-.beta. superfamily member are preferably from about 5 to about 95, more preferably from about 10 to about 90, still more preferably from about 20 to about 80 and most preferably from about 30 to about 70 contiguous amino acids. For example, a particular crossover point might be between the third and fourth canonical framework cysteine residues. One such exemplary construct would contain at the 5' and a sequence comprised of a persephin sequence from residue 1 through the third canonical framework cysteine residue 37 and up to a cross-over point somewhere between residue 37 and residue 63 but not including the fourth canonical framework cysteine residue 64 (for reference, see mature persephin, SEQ ID NO:80). The 3' end of the hybrid construct would constitute a sequence derived from another TGF-.beta. superfamily member such as, for example, neurturin which is another TGF-.beta. superfamily member that is closely related to persephin. Using neurturin as the other TGF-.beta. family member, the hybrid construct beyond the crossover point would be comprised of a sequence beginning at the desired crossover point in the neurturin sequence between the third canonical framework cysteine residua 37 and the fourth canonical framework cysteine residue 67 of neurturin and continuing through residue 100 at the 3' end of neurturin (for alignment, see FIG. 12). A second exemplary hybrid construct would be comprised of residue 1 through a crossover point between residues 37 and 67 of neurturin contiguously linked with residues from the crossover point between residues 37 and 64 through residue 96 of persephin. The above constructs with persephin and neurturin are intended as examples only with the particular TGF-.beta. family member being selected from family members including but not limited to transforming growth factor-.beta.1 (TGF.beta.1), transforming growth factor-.beta.2 (TGF.beta.2), transforming growth factor-.beta.3 (TGF.beta.3), inhibin .beta. A (INH.beta.A), inhibin .beta. B (INH.beta.B), the nodal gene (NODAL), bone morphogenetic proteins 2 and 4 (BMP2 and BMP4), the Drosophila decapentaplegic gene (dpp), bone morphogenetic proteins 5-8 (BNP5, BMP6, BMP7 and BMP8), the Drosophila 60A gene family (60A), bone morphogenetic protein 3 (BMP2), the Vgl gene, growth differentiation factors 1 and 3 (GDF1 and GDF2), dorsalin (drsln), inhibin .alpha. (INH.alpha.), the MIS gene (MIS), growth factor 9 (GDF-9), glial-derived neurotropic growth factor (GDNF), neurturin (NTN) and persephin (see FIG. 16). In addition, the crossover point can be any residue between the first and seventh canonical framework cysteines molecules of neurturin and the particular other family member. Furthermore, additional crossover points can be used to incorporate any desired number of persephin portions or fragments with portions or fragments of any one or more other family members. In constructing a particular chimeric molecule, the portions of persephin and portions of the other, non-persephin growth factor are amplified using PCR, mixed and used as template for a PCR reaction using the forward primer from one and the reverse primer from the other of the two component portions of the chimeric molecule. Thus, for example a forward and reverse primers are selected to amplify the portion of persephin from the beginning to the selected crossover point between the third and fourth canonical cysteine residues using a persephin plasmid as template. A forward primer with a 5' portion overlapping with the persephin sequence and a reverse primer are then used to amplify the portion of the other, non-persephin growth factor member of the TGF-.beta. superfamily from the corresponding crossover point through the 3' end using a plasmid template containing the coding sequence for the non-persephin TGF-.beta. family member. The products of the two PCR reactions are gel purified and mixed together and a PCR reaction performed. Using an aliquot of this reaction as template a PCR reaction is performed using the persephin forward primer and the reverse primer for the non-persephin growth factor. The product is then cloned into an expression vector for production of the chimeric molecule. Chimeric growth factors would be expected to be effective in promoting the growth and development of cells and for use in preventing the atrophy, degeneration or death of cells, particular in neurons. The chimeric polypeptides may also act as a receptor antagonists of one or both of the full length growth factors from which the chimeric polypeptide was constructed or as an antagonist of any other growth factor that acts at the same receptor or receptors. The present invention also includes therapeutic or pharmaceutical compositions comprising persephin or neurturin in an effective amount for treating patients with cellular degeneration or dysfunction and a method comprising administering a therapeutically effective amount of neurturin or persephin. These compositions and methods are useful for treating a number of degenerative diseases. Where the cellular degeneration involves neuronal degeneration, the diseases include, but are not limited to peripheral neuropathy, amyotrophic lateral sclerosis, Alzheimer's disease, Parkinson's disease, Huntington's disease, ischemic stroke, acute brain injury, acute spinal chord injury, nervous system tumors, multiple sclerosis, peripheral nerve trauma or injury, exposure to neurotoxins, metabolic diseases such as diabetes or renal dysfunctions and damage caused by infectious agents. In particular, the ability of persephin to promote survival in mesencephalic cells suggests an applicability of this growth factor in treating neuronal degenerative diseases of the CNS such as Parkinson's disease. Where the cellular degeneration involves bone marrow cell degeneration, the diseases include, but are not limited to disorders of insufficient blood cells such as, for example, leukopenias including eosinopenia and/or basopenia, lymphopenia, monocytopenia, neutropenia, anemias, thrombocytopenia as well as an insufficiency of stem cells for any of the above. The cellular degeneration can also involve myocardial muscle cells in diseases such as cardiomyopathy and congestive heart failure. The above cells and tissues can also be treated for depressed function. The compositions and methods herein can also be useful to prevent degeneration and/or promote survival in other non-neuronal tissues as well. One skilled in the art can readily determine using a variety of assays known in the art for identifying whether neurturin or persephin would be useful in promoting survival or functioning in a particular cell type. In certain circumstances, it may be desirable to modulate or decrease the amount of persephin or neurturin expressed. Thus, in another aspect of the present invention, persephin or neurturin anti-sense oligonucleotides can be made and a method utilized for diminishing the level of expression of persephin or neurturin, respectively, by a call comprising administering one or more persephin or neurturin anti-sense oligonucleotides. By persephin or neurturin anti-sense oligonucleotides reference is made to oligonucleotides that have a nucleotide sequence that interacts through base pairing with a specific complementary nucleic acid sequence involved in the expression of persephin or neurturin, respectively, such that the expression of persephin or neurturin is reduced. Preferably, the specific nucleic acid sequence involved in the expression of persephin or neurturin is a genomic DNA molecule or mRNA molecule that contains sequences of the persephin or neurturin gene. This genomic DNA molecule can comprise flanking regions of the persephin or neurturin gene, untranslated regions of persephin or neurturin mRNA, the pre- or pro- portions of the persephin or neurturin gene or the coding sequence for mature persephin or neurturin protein. The term complementary to a nucleotide sequence in the context of persephin or neurturin antisense oligonucleotides and methods therefore means sufficiently complementary to such a sequence as to allow hybridization to that sequence in a cell, i.e., under physiological conditions. The persephin or neurturin antisense oligonucleotides preferably comprise a sequence containing from about 8 to about 100 nucleotides and more preferably the persephin or neurturin antisense oligonucleotides comprise from about 15 to about 30 nucleotides. The persephin or neurturin antisense oligonucleotides can also contain a variety of modifications that confer resistance to nucleolytic degradation such as, for example, modified internucleoside linkages (Uhlmann and Psyman, Chemical Reviews 90:543-548, 1990; Schneider and Banner, Tetrahedron Lett 31:335, 1990 which are incorporated by reference), modified nucleic acid bases and/or sugars and the like. The therapeutic or pharmaceutical compositions of the present invention can be administered by any suitable route known in the art including for example intravenous, subcutaneous, intramuscular, transdermal, intrathecal or intracerebral. Administration can be either rapid as by injection or over a period of time as by slow infusion or administration of slow release formulation. For treating tissues in the central nervous system, administration can be by injection or infusion into the cerebrospinal fluid (CSF). When it is intended that neurturin or persephin be administered to cells in the central nervous system, administration can be with one or more agents capable of promoting penetration of neurturin or persephin across the blood-brain barrier. Persephin or neurturin can also be linked or conjugated with agents that provide desirable pharmaceutical or pharmacodynamic properties. For example, persephin or neurturin can be coupled to any substance known in the art to promote penetration or transport across the blood-brain barrier such as an antibody to the transferrin receptor, and administered by intravenous injection. (See for example, Friden et al., Science 259:373-377, 1993 which is incorporated by reference). Furthermore, persephin or neurturin can be stably linked to a polymer such as polyethylene glycol to obtain desirable properties of solubility, stability, half-life and other pharmaceutically advantageous properties. (see for example Davis et al. Enzyme Eng 4:169-73, 1978, Burnham, Am J Hosp Pharm 51:210-218, 1994 which are incorporated by reference). The compositions are usually employed in the form of pharmaceutical preparations. Such preparations are made in a manner well known in the pharmaceutical art. One preferred preparation utilizes a vehicle of physiological saline solution, but it is contemplated that other pharmaceutically acceptable carriers such as physiological concentrations of other non-toxic salts, five percent aqueous glucose solution, sterile water or the like may also be used. It may also be desirable that a suitable buffer be present in the composition. Such solutions can, if desired, be lyophilized and stored in a sterile ampoule ready for reconstitution by the addition of sterile water for ready injection. The primary solvent can be aqueous or alternatively non-aqueous. Persephin or neurturin can also be incorporated into a solid or semi-solid biologically compatible matrix which can be implanted into tissues requiring treatment. The carrier can also contain other pharmaceutically-acceptable excipients for modifying or maintaining the pH, osmolarity, viscosity, clarity, color, sterility, stability, rate of dissolution, or odor of the formulation. Similarly, the carrier may contain still other pharmaceutically-acceptable excipients for modifying or maintaining release or absorption or penetration across the blood-brain barrier. Such excipients are those substances usually and customarily employed to formulate dosages for parenteral administration in either unit dosage or multi-dome form or for direct infusion into the cerebrospinal fluid by continuous or periodic infusion. Dose administration can be repeated depending upon the pharmacokinetic parameters of the dosage formulation and the route of administration used. It is also contemplated that certain formulations containing persephin or neurturin are to be administered orally. Such formulations are preferably encapsulated and formulated with suitable carriers in solid dosage forms. Some examples of suitable carriers, excipients, and diluents include lactose, dextrose, sucrose, sorbitol, mannitol, starches, gum acacia, calcium phosphate, alginates, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, gelatin, syrup, methyl cellulose, methyl- and propylhydroxybenzoates, talc, magnesium, stearate, water, mineral oil, and the like. The formulations can additionally include lubricating agents, wetting agents, emulsifying and suspending agents, preserving agents, sweetening agents or flavoring agents. The compositions may be formulated so as to provide rapid, sustained, or delayed release of the active ingredients after administration to the patient by employing procedures well known in the art. The formulations can also contain substances that diminish proteolytic degradation and promote absorption such as, for example, surface active agents. The specific dose is calculated according to the approximate body weight or body surface area of the patient or the volume of body apace to be occupied. The dose will also be calculated dependent upon the particular route of administration selected. Further refinement of the calculations necessary to determine the appropriate dosage for treatment is routinely made by those of ordinary skill in the art. Such calculations can be made without undue experimentation by one skilled in the art in light of the activity of neurturin or GDNF. With neurturin the activity in target cells data is disclosed herein and in copending application Ser. NO. 08/519,777, now U.S. Pat. No. 5,739,307 and in the case or persephin, the concentration required for activity at the cellular level is believed to be similar to that of neurturin. Persephin activity on a particular target cell type can be determined by routine experimentation. Exact dosages are determined in conjunction with standard dose-response studies. It will be understood that the amount of the composition actually administered will be determined by a practitioner, in the light of the relevant circumstances including the condition or conditions to be treated, the choice of composition to be administered, the age, weight, and response of the individual patient, the severity of the patient's symptoms, and the chosen route of administration. In one embodiment of this invention, persephin or neurturin may be therapeutically administered by implanting into patients vectors or cells capable of producing a biologically-active form of persephin or neurturin or a precursor of persephin or neurturin, i.e. a molecule that can be readily converted to a biological-active form of neurturin by the body. In one approach cells that secrete persephin or neurturin may be encapsulated into semipermeable membranes for implantation into a patient. The cells can be cells that normally express persephin or neurturin or a precursor thereof or the cells can be transformed to express persephin or neurturin or a precursor thereof. It is preferred that the cell be of human origin and that the persephin or neurturin be human persephin or neurturin when the patient is human. However, the formulations and methods herein can be used for veterinary as well as human applications and the term "patient" as used herein is intended to include human and veterinary patients. Cells can be grown ex vivo for use in transplantation or engraftment into patients (Muench et al., Leuk & Lymph 16:1-11, 1994 which is incorporated by reference). In another embodiment of the present invention, persephin or neurturin is used to promote the ex vivo expansion of a cello for transplantation or engraftment. Current methods have used bioreactor culture systems containing factors such as erythropoietin, colony stimulating factors, stem call factor, and interleukins to expand hematopoietic progenitor cells for erythrocytes, monocytes, neutrophils, and lymphocytes (Verfaillie, Stem Cells 12:466-476, 1994 which is incorporated by reference). These stem cells can be isolated from the marrow of human donors, from human peripheral blood, or from umbilical cord blood cells. The expanded blood cells are used to treat patients who lack these cells as a result of specific disease conditions or as a result of high dose chemotherapy for treatment of malignancy (George, Stem Cells 12(Suppl 1):249-255, 1994 which is incorporated by reference). In the case of cell transplant after chemotherapy, autologous transplants can be performed by removing bone marrow cells before chemotherapy, expanding the cells ex vivo using methods that also function to purge malignant cells, and transplanting the expended cells back into the patient following chemotherapy (for review see Rummel and Van Zant, J Hematotherapy 3:213-218, 1994 which is incorporated by reference). Since persephin or neurturin Is believed to be expressed in the developing animal in blood, bone marrow and liver, tissues where proliferation and differentiation of progenitor cells occur, it is believed that persephin or neurturin can function to regulate the proliferation of hematopoietic stem cells and the differentiation of mature hematopoietic cells. Thus, the addition of persephin or neurturin to culture systems used for ex vivo expansion of cells could stimulate the rate at which certain populations of cells multiply or differentiate, and improve the effectiveness of these expansion systems in generating cells needed for transplant. It is also believed that persephin or neurturin can be used for the ex vivo expansion of precursor cells in the nervous system. Transplant or engraftment of cells is currently being explored as a therapy for diseases in which certain populations of neurons are lost due to degeneration such as, for example, in Parkinson's disease (Bjorklund, Curr Opin Neurobiol 2:683-689, 1992 which is incorporated by reference). Neuronal precursor cells can be obtained from animal or human donors or from human fetal tissue and then expanded in culture using persephin or neurturin or other growth factors. These cells can then be engrafted into patients where they would function to replace some of the cells lost due to degeneration. Because neurotrophins have been shown to be capable of stimulating the survival and proliferation of neuronal precursors cells such as, for example, NT-3 stimulation of sympathetic neuroblast cells (Birren et al., Develop 119:597-610, 1993 which is incorporated by reference), persephin or neurturin could also function in similar ways during the development of the nervous system and could be useful in the ex vivo expansion of neuronal cells. In a number of circumstance it would be desirable to determine the levels of persephin or neurturin in a patient. The identification of persephin or neur |